PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009907
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 308aa    MW: 33696.6 Da    PI: 6.1032
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009907genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.77e-10117168556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +   
  Lus10009907 117 KRAKRILANRQSAARSKERKARYIIELERKVQTLQTEATTLSAQLTLFQRDT 168
                  9****************************************99987766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.7E-16113177IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.53115178IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.54E-10117168No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-9117171No hitNo description
PfamPF001701.2E-8117172IPR004827Basic-leucine zipper domain
CDDcd147033.96E-23118167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSFRFPDDMT MMMMDLSPSG PMTPGAGGGD GGSSTCSLEE IGSEDDLFST YIDVDKLTGG  60
VNNSADQSNS TTPSSRPATK HRHSNSVDGS GMFGEIMDAK KAMPPEKLAD LWNVDPKRAK  120
RILANRQSAA RSKERKARYI IELERKVQTL QTEATTLSAQ LTLFQRDTSG LSTENTELKL  180
RLQALEQQAQ LRDALNDALK TEVERLKVAT GEMMSHSESF NLGMHQMPYS SSNFFPLPPQ  240
QSGHTRNMQL PHFSQHMQQP NSHPLSDAMQ SESLARFQGL DISNKGQPNI VKSEGSSICA  300
SESSSTF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325642.21e-146hypothetical protein POPTR_0019s15040g
SwissprotQ6S4P48e-99RF2B_ORYSJ; Transcription factor RF2b
TrEMBLB9INM11e-146B9INM1_POPTR; Uncharacterized protein
STRINGPOPTR_0019s15040.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15483497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.13e-73basic leucine-zipper 52